PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_12442.1_g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family CPP
Protein Properties Length: 540aa    MW: 60192 Da    PI: 5.5759
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_12442.1_g00002.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR48.51.7e-15381419240
                      TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                              ++k+C+CkkskClk+YC+Cfaag +C e C+C++C+N+ 
  Rsa1.0_12442.1_g00002.1 381 SCKRCRCKKSKCLKLYCDCFAAGLYCVEPCSCQNCFNRP 419
                              589**********************************85 PP

2TCR29.21.9e-09463482221
                      TCR   2 ekkgCnCkkskClkkYCeCf 21 
                              +++gCnCkks C kkYCeC+
  Rsa1.0_12442.1_g00002.1 463 HMRGCNCKKSGCSKKYCECY 482
                              889****************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011143.8E-16380421IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163426.324381482IPR005172CRC domain
PfamPF036385.9E-11383418IPR005172CRC domain
SMARTSM011140.0062462491IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.2E-5465482IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 540 aa     Download sequence    Send to blast
MGTPDKNRIS AVSYCNFEDS PVFQYINGLS PIEPLKAEHA ADHVFHSLAL ASPSSSLFSS  60
PQIEESYRDS RFLIKRHHHS LDLSTPICLI DETVKNTPDV LKRCQVKLSI ELASSLRNGE  120
DDQMTTSSDE VVPMDDENEI AIKQSDGLCG QPYELDESDG VFQTEEMETE NGYGEQEIPN  180
AKDPRINSFT SVPQQFSTNS RNVVQSRSVQ VAGGAPDTTL SSSSNVAAIG STAKAEDKKE  240
TGQQLSRKQR SVRRRCLTFD VGESNKRVPL RDSTNDLPLD FTSINEASSP QKCVDSSKQE  300
TDEIVPIPRT IGLHLNALVN PSASSNRNRL TSKDGCVLSR AEEEFKTPLS TIKDLVSYDI  360
QIMEEASEKS MEGEWVEELG SCKRCRCKKS KCLKLYCDCF AAGLYCVEPC SCQNCFNRPI  420
HEDVVMKTRR NVEARNPLAF APKVVSATYF REEDNKTPAS ARHMRGCNCK KSGCSKKYCE  480
CYLVSLVSLL ALFILCPFIL LNYWILKMIL LSRWALDARR AAEQLHLPCA VESDAVTIKE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1893291e-116AC189329.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB037C07, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009134792.10.0PREDICTED: protein tesmin/TSO1-like CXC 4
SwissprotQ84JZ80.0TCX4_ARATH; Protein tesmin/TSO1-like CXC 4
TrEMBLM4CA990.0M4CA99_BRARP; Uncharacterized protein
STRINGBra001128.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM148401620
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04850.11e-152Tesmin/TSO1-like CXC domain-containing protein